PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.300610.4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family WRKY
Protein Properties Length: 235aa    MW: 24809.2 Da    PI: 5.1851
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.300610.4genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY57.52.8e-18691161259
                     EE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY  12 qKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     q + + s++ +sYYrCtsa C+vkk+vers  dp+vv++tYeg+H+h+
  Cucsa.300610.4  69 QQQQQHSPTKQSYYRCTSAACNVKKRVERSFADPTVVVTTYEGQHTHP 116
                     5666789999*************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081119.80753118IPR003657WRKY domain
SMARTSM007741.4E-1069117IPR003657WRKY domain
SuperFamilySSF1182901.57E-1469118IPR003657WRKY domain
PfamPF031061.5E-1269116IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.5E-1669118IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009624Biological Processresponse to nematode
GO:0009733Biological Processresponse to auxin
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 235 aa     Download sequence    Send to blast
MEDYNNNNDD DQQQIIKIED TSTITDAGGG GDGGGRGGGG ATPNCSSSVS SASSDALNDD  60
EPPPPPPPQQ QQQHSPTKQS YYRCTSAACN VKKRVERSFA DPTVVVTTYE GQHTHPSPIL  120
SRSALAVAIP PPSFIPGAGG ECVGGVVAMP WLKPSNNDAH DGNTIPAMSH QYFQNSTYIT  180
AQNVAANYNR NNHIGAANAA GILQEKRFCN PNSSFLVDHG LLQDVVPPHM LKQE*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13339GGRGGGG
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00069PBMTransfer from AT2G47260Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGU9840400.0GU984040.1 Cucumis sativus WRKY protein (WRKY55) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011651538.11e-114PREDICTED: probable WRKY transcription factor 68 isoform X1
RefseqXP_011651539.11e-114PREDICTED: probable WRKY transcription factor 68 isoform X1
TrEMBLE7CEY91e-114E7CEY9_CUCSA; WRKY protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G62340.12e-21WRKY family protein